GHRH receptor is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-12-24. Where a claim depends on a specific study, the study is described rather than over-claimed.
The albumin-binding version stays in circulation for days, because covalent attachment to serum albumin shields the peptide from rapid filtration and degradation. Reported half-lives for this form fall in the range of several days. The version without the linker is cleared in minutes, with estimates often near thirty minutes in animal work. These figures come from small studies and vary with assay method, species, and route, so they are best read as approximate rather than fixed constants.
Studies in this area generally track growth hormone pulses, insulin-like growth factor 1 concentrations, and occasionally body composition endpoints. Most published human data come from early, small trials, and questions about long-term effects remain open. Whether repeated exposure alters pituitary responsiveness over time is not settled. Analytical work relies on immunoassays for the hormones and on mass spectrometry for the peptide itself, because the two measurements answer different questions.
CJC-1295 belongs to a family of synthetic peptides modeled on growth hormone-releasing hormone, the hypothalamic signal that prompts the pituitary to release growth hormone. The compound is built from the first twenty-nine amino acids of the natural human sequence, a fragment that retains full receptor binding capacity. Native growth hormone-releasing hormone is degraded quickly in circulation, so the fragment alone has limited practical value. Early work therefore focused on chemical modifications that preserve receptor binding while slowing enzymatic breakdown. The result is a molecule described in the literature as a long-acting analog of the natural hormone.
Two forms circulate under the CJC-1295 name, and they differ by a single appended group. The version without a drug affinity complex carries four substitutions along the peptide chain, including a D-alanine near the amino terminus and replacements at three other positions. These changes block the enzyme dipeptidyl peptidase IV and remove a methionine residue that is prone to oxidation. The modified fragment is frequently labeled MOD GRF 1-29. Naming conventions are inconsistent across informal sources, which is a common source of confusion.
| Property | Value | Notes |
|---|---|---|
| Target receptor | GHRH receptor (GHRHR) | Expressed on pituitary somatotrophs |
| Primary action | Stimulates growth hormone release | Amplifies pulse size |
| Half-life, albumin-binding form | Several days as reported | Slow release from albumin complex |
| Half-life, unmodified analog | About 30 minutes in animal estimates | Cleared by proteases and filtration |
| Common analytical approach | LC-MS/MS for peptide, immunoassay for hormones | Methods answer different questions |
Two related forms circulate in technical discussion under the same family name. The original version carries a drug affinity complex (DAC) that binds covalently to serum albumin after administration, and this linkage substantially extends circulation time. A second form, frequently written as modified GRF(1-29) or CJC-1295 without DAC, lacks that linker and clears much faster. The naming is a frequent source of confusion because the shorthand CJC-1295 can refer to either form depending on the source. Reports sometimes fail to specify which variant was studied.
The peptide backbone includes a D-alanine at position two, which resists cleavage by dipeptidyl peptidase IV, and several other substitutions that reduce degradation. Its molecular weight is roughly 3.4 kDa without the linker and about 3.6 kDa with it. The molecule is water soluble and is normally supplied as a lyophilized powder. Precise sequence and mass values depend on which variant is described, so technical documents usually state the exact form being referenced.
Reported half-lives differ widely between the two variants and between species. Values for the albumin-binding form are usually expressed in days, while the unconjugated form is measured in minutes to a few hours. Sampling schedules, assay sensitivity, and route of administration all influence the numbers, which limits direct comparison across studies. Whether sustained receptor occupancy produces different downstream effects from pulsatile stimulation remains an open question in the published work. Claims about relative potency should therefore be read alongside the specific study design that produced them.
Lyophilised powder is the usual supplied form. The material is hygroscopic, so vials are typically equilibrated to room temperature before opening in order to prevent condensation on the contents. Long-term storage is generally described at minus twenty degrees Celsius or colder, protected from light and moisture. Repeated freeze-thaw cycles are avoided because they promote aggregation and loss of soluble material. A reconstituted solution is considerably less stable than the dry powder and is normally kept refrigerated for short periods only.
Binding to GHRH receptors on pituitary somatotroph cells triggers cyclic AMP signaling and stimulates growth hormone synthesis and release. Because the peptide acts upstream of the pituitary, effects are mediated through endogenous growth hormone rather than direct receptor activation in peripheral tissues. Increases in insulin-like growth factor 1 are generally described as a downstream consequence. Most published human exposure data come from small early-stage studies, and the clinical significance of the pharmacokinetic profile remains incompletely characterized.
CJC-1295 is a synthetic analogue of growth hormone-releasing hormone, built on the 29-amino-acid GHRH(1-29) fragment. Four substitutions distinguish it from the natural sequence: D-alanine at position 2, glutamine at position 8, alanine at position 15, and leucine at position 27. These changes reduce enzymatic cleavage and extend the peptide's persistence in circulation. The compound is discussed in two forms, one carrying a drug affinity complex and one without it.
== Function == Dietary copper enters the bloodstream primarily in its oxidized Cu(II) form. Once absorbed, Cu(II) is taken up by the hCTR1, which mediates its cellular import. At the extracellular face, the flexible N-termini extends outward and captures Cu(II) from the blood carrier protein, after that it reduces Cu(II) to Cu(I) state and preserves the reduced Cu(I) oxidation state. The extracellular domain of hCTR1 holds both Cu(II) and Cu(I) binding sites: 1MDHxHH and 22HHH, serve as two Cu(II) binding sites; 7MxMxxM and 41MMMxM, comprise the first Cu(I) binding sites in the extracellular domain of hCTR1. The extracellular hCTR1 domain is also characterized by two glycosylation sites, N15 and T27. The transmembrane domain of hCTR1 is characterized by 150MxxxM and 167GxxxG motifs. In the second transmembrane helix, M150 and M154 are considered as Cu(I)-binding residues. There are two methionine triads lining the pore, and these methionine rings have soft sulfur ligands and create the "selectivity filter" for Cu(I), that excludes harder ions such as Ca(II). The hCTR1 C-terminal domain controls the distribution of Cu(I), it plays a role in copper trafficking and regulation. It interacts with metallochaperones and with the of the 188HCH motif transfers the Cu(I) ion to Atox1. Althogether hCTR1 operates as a dynamic, adaptable transporter, delicately balancing the flexibility and selectivity of copper ions.
== Adverse effects == The most common adverse reactions include upper respiratory tract infections, vomiting, cough, other viral infections, headache, gastroenteritis, and pharyngitis (sore throat). An increased risk of fractures, including serious fractures, was observed in people treated with apitegromab. Apitegromab may cause fetal harm and may affect reproductive function.
== Politics == Christian Heritage Party (disambiguation) Christian Historical Party (1903–1908), a Dutch conservative party Republican People's Party (Cumhuriyet Halk Partisi), a Turkish centre-left party
=== Number average molar mass === The number average molar mass is a way of determining the molecular mass of a polymer. Polymer molecules, even ones of the same type, come in different sizes (chain lengths, for linear polymers), so the average molecular mass will depend on the method of averaging. The number average molecular mass is the ordinary arithmetic mean or average of the molecular masses of the individual macromolecules. It is determined by measuring the molecular mass of n polymer molecules, summing the masses, and dividing by n.
Enhance the two laboratories' national security missions by substantially increasing engagement with the private sector and academic community. Stay at the forefront of the science, technology and engineering fields. Ensure a quality future workforce by expanding opportunities for open engagement of the broader scientific community.
Sources: en.wikipedia.org
The diagram shows a simplified decay scheme of 60Co and 60mCo. The main β-decay transitions are shown. The probability for population of the middle energy level of 2.1 MeV by β-decay is only 0.0022%, with a β-energy of 0.67 MeV. Transitions between the three levels generate six different gamma-ray frequencies. In the diagram the two important ones are marked. Internal conversion is not significant. The half-value and 1/10th value layer thickness for shielding against this isotope's radiations has been determined for different materials:
This is a list of prices of chemical elements. Listed here are mainly average market prices for bulk trade of commodities. Data on elements' abundance in Earth's crust is added for comparison. As of 2025, the most expensive non-synthetic element by mass is rhodium, and by volume, iridium. It is followed by rhodium, caesium, iridium and palladium by mass and iridium, gold and platinum by volume. Carbon in the form of diamond can be more expensive than rhodium. Per-kilogram prices of some synthetic radioisotopes range to trillions of dollars. While the difficulty of obtaining macroscopic samples of synthetic elements in part explains their high value, there has been interest in converting base metals to gold (chrysopoeia) since ancient times, but only deeper understanding of nuclear physics has allowed the actual production of a tiny amount of gold from other elements for research purposes as demonstrated by Glenn Seaborg. However, both this and other routes of synthesis of precious metals via nuclear reactions is orders of magnitude removed from economic viability. Chlorine, sulfur and carbon (as coal) are cheapest by mass. Hydrogen, nitrogen, oxygen and chlorine are cheapest by volume at atmospheric pressure. When there is no public data on the element in its pure form, price of a compound is used, per mass of element contained. This implicitly puts the value of compounds' other constituents, and the cost of extraction of the element, at zero. For elements whose radiological properties are important, individual isotopes and isomers are listed.
Six reserve landing grounds were constructed for landing and take-off instruction to prevent congestion on the main airstrips. Later in the war, a dedicated air station was designated for the training of instructors. Small administrative units were established in South Africa at Cape Town, Durban and Port Elizabeth to handle incoming equipment and arrivals and departures of personnel. The complete pilot's course initially lasted six months, split into two months each of elementary, intermediate and advanced instruction. Ground subjects were also taught and each trainee had to fly at least 150 hours to qualify. By the end of the war each period had been shortened by a week to speed up the output of trained pilots. The trainees were mostly British, but came from all over the world. "The diversity of nationalities under training was surprising and impressive," reported one officer. "British, South African, New Zealand, Australian, Canadian, American, men from Yugoslavia, Greece, Free France, Poland, Czechoslovakia, Kenya, Uganda, Tanganyika, Fiji Isles, Malta." "[Southern Rhodesia's] part in the Commonwealth Air Training Scheme has been outstandingly fine," Sir James Ross of the British Air Ministry reported in 1942. "I say this from knowledge and without qualification. ... I know how gratefully the Air Staff in London reckon on the unfailingly regular flow of well-trained pilots and observers, course after course, month after month."
Petroleum in some form has been used since ancient times. More than 4,300 years ago, bitumen was mentioned when the Sumerians used it to make boats. A tablet of the legend of the birth of Sargon of Akkad mentions a basket which was closed by straw and bitumen. More than 4,000 years ago, according to Herodotus and Diodorus Siculus, asphalt (bitumen) was used in the construction of the walls and towers of Babylon; there were oil pits near Ardericca and Babylon and a pitch spring on Zakynthos. In Babylon, petroleum was used for road construction, ship caulking, and medicine. The use of petroleum in ancient China dates back more than 2,000 years. The I Ching, one of the earliest Chinese writings, cites that oil in its raw state, without refining, was first discovered, extracted, and used in China in the 1st century BCE. In addition, the Chinese were the first to record the use of petroleum as fuel as early as the 4th century BCE. By 347 CE, oil was produced from bamboo-drilled wells in China. In the 7th century, petroleum was among the essential ingredients for Greek fire, an incendiary projectile weapon that was used by Byzantine Greeks against Arab ships attacking Constantinople. Crude oil was distilled by Persian chemists, with clear descriptions given in Arabic handbooks such as those of Abu Bakr al-Razi. In the 9th century, oil fields were exploited in the area around modern Baku, Azerbaijan. These fields were described by Abu Bakr al-Razi in the 10th century and by Marco Polo in the 13th century, who describes the output of those wells as hundreds of shiploads.
Sources: en.wikipedia.org
== First published posthumously == De Profundis (written 1895–97, in Reading Gaol). Expurgated edition published 1905; suppressed portions 1913, expanded version in The Letters of Oscar Wilde (1962). The Rise of Historical Criticism (written while at college). First published in 1905 (Sherwood Press, Hartford, CT), privately printed. Reprinted in Miscellanies, the last volume of the First Collected Edition (1908). The First Collected Edition (Methuen & Co., 14 volumes) appeared in 1908 and contained many previously unpublished works. The Second Collected Edition (Methuen & Co., 12 volumes) appeared in installments between 1909–11 and contained several other unpublished works. The Letters of Oscar Wilde (written 1868–1900). Published in 1962. Republished as The Complete Letters of Oscar Wilde (2000), with letters discovered since 1962 and new annotations by Merlin Holland. The Women of Homer (written 1876, while at college). First published in Oscar Wilde: The Women of Homer (2008) by the Oscar Wilde Society.
On 1 July 1972 at Villamanrique de la Condesa, near Seville, Spain, he married Princess Maria da Gloria of Orléans-Braganza (b. 1946) from the Brazilian imperial family, at the parish church of St. Mary Magdalene. They are double 4th cousins once removed as both are descendants of Prince Ferdinand of Saxe-Coburg and Gotha (1785–1851) and Princess Maria Antonia von Koháry (1797–1862), as well as of Pedro I, Emperor of Brazil and Archduchess Maria Leopoldina of Austria. They have three sons: Peter (born 5 February 1980), and fraternal twins: Philip and Alexander (both born 15 January 1982). Alexander and Maria da Gloria divorced on 19 February 1985. Both of them married for the second time. Maria da Gloria married Ignacio de Medina, Duke of Segorbe (b. 1947), while Crown Prince Alexander married Katherine Clairy Batis, daughter of Robert Batis and Anna Dosti, civilly on 20 September 1985, and religiously the following day, at St. Sava Serbian Orthodox Church, Notting Hill, London. Since their marriage, she is known as Crown Princess Katherine, as per the royal family's website. On 16 December 2017, Alexander attended with his wife the state funeral of his first cousin once removed, King Michael of Romania in Bucharest, along with other heads of European royal families and invited guests. On 19 September 2022, Crown Prince Alexander and his wife Katherine attended the state funeral of his godmother Queen Elizabeth II.
The farming of fish is the most common form of aquaculture. It involves raising fish commercially in tanks, fish ponds, or ocean enclosures, usually for food. A facility that releases juvenile fish into the wild for recreational fishing or to supplement a species' natural numbers is generally referred to as a fish hatchery. Worldwide, the most important fish species used in fish farming are, in order, carp, salmon, tilapia, and catfish. In the Mediterranean, young bluefin tuna are netted at sea and towed slowly towards the shore. They are then interned in offshore pens (sometimes made from floating HDPE pipe) where they are further grown for the market. In 2009, researchers in Australia managed for the first time to coax southern bluefin tuna to breed in landlocked tanks. Southern bluefin tuna are also caught in the wild and fattened in grow-out sea cages in southern Spencer Gulf, South Australia. A similar process is used in the salmon-farming section of this industry; juveniles are taken from hatcheries and a variety of methods are used to aid them in their maturation. For example, as stated above, some of the most important fish species in the industry, salmon, can be grown using a cage system. This is done by having netted cages, preferably in open water that has a strong flow, and feeding the salmon a special food mixture that aids their growth. This process allows for year-round growth of the fish, thus a higher harvest during the correct seasons. An additional method, known sometimes as sea ranching, has also been used within the industry.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
=== Branched-chain amino acids === Several studies have attempted to decrease the synthesis of serotonin by administering branched-chain amino acids and inhibiting the transport of tryptophan across the blood brain barrier. The studies performed resulted in little or no change in performance between increased BCAA intake and placebo groups. One study in particular administered a carbohydrate solution and a carbohydrate + BCAA solution. Both of the groups were able to run for longer before fatigue compared to the water placebo group. However, both the carbohydrate and the carbohydrate + BCAA groups had no differences in their performance. Branch-chained amino acid supplementation has proven to have little to no effect on performance. There has been little success utilizing neurotransmitter precursors to control central nervous system fatigue. One review hypothesized that the inconsistency with BCAA administration was the result of ammonia accumulation as a result of increased BCAA oxidation.
Sources: en.wikipedia.org
Reported values cluster in the range of several days, reflecting slow release from the albumin complex. Estimates differ across species and assay platforms. The figure describes circulation time in study settings rather than a fixed property.
Typical endpoints include growth hormone pulse frequency and amplitude, together with insulin-like growth factor 1 concentration. Some protocols add body composition or metabolic markers. Interpretation depends on baseline hormonal status, which varies widely between individuals.
Most human data come from small, early-stage studies, and independent replication is limited. Short-term effects on growth hormone release are documented; longer-term outcomes are not well characterized. Open questions include changes in pituitary responsiveness after repeated exposure.
No. It is a synthetic analogue modeled on the first 29 residues of human GHRH. The substitutions and any linker are laboratory modifications rather than features of the endogenous peptide.